A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10023
Swiss-prot Accession number	O46688 (Sequence in FASTA format)
Description	Somatostatin precursor [Contains: Somatostatin-28; Somatostatin-14].
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatostatin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Somatostatin inhibits the release of somatotropin
Protein Length	116 Amino acids
Molecular weight	12689
References	1  PubMed abstract 9880082
Domain Name	Somatostatin
Hormone Name	Somatostatin-14
Mature Hormone Sequence	AGCKNFFWKTFTSC
Position of mature hormone in Pre-Hormone protein	14 Residues from position (103-116)
Receptor	Q8MI04    Detail in HMRbase
Gene ID	443006
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 2

HMRbase accession number	10072
Swiss-prot Accession number	Q8WN12 (Sequence in FASTA format)
Description	Prolactin-releasing peptide precursor (PrRP) (Prolactin-releasinghormone) [Contains: Prolactin-releasing peptide PrRP31; Prolactin-releasing peptide PrRP20].
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	N/A
Tissue Specificity	More abundantly expressed in the brainstem than the hypothalamus
Post translational modification	N/A
Function	Stimulates prolactin (PRL) release and regulates the expression of prolactin through its receptor GPR10. May stimulate lactotrophs directly to secrete PRL
Protein Length	98 Amino acids
Molecular weight	10513
References	1  PubMed abstract 12098662
Domain Name	N/A
Hormone Name	Prolactin-releasing peptide PrRP31
Mature Hormone Sequence	SRAHQHSMEIRTPDINPAWYAGRGIRPVGRF
Position of mature hormone in Pre-Hormone protein	31 Residues from position (23-53)
Receptor	N/A
Gene ID	443466
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	10073
Swiss-prot Accession number	Q8WN12 (Sequence in FASTA format)
Description	Prolactin-releasing peptide precursor (PrRP) (Prolactin-releasinghormone) [Contains: Prolactin-releasing peptide PrRP31; Prolactin-releasing peptide PrRP20].
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	N/A
Tissue Specificity	More abundantly expressed in the brainstem than the hypothalamus
Post translational modification	N/A
Function	Stimulates prolactin (PRL) release and regulates the expression of prolactin through its receptor GPR10. May stimulate lactotrophs directly to secrete PRL
Protein Length	98 Amino acids
Molecular weight	10513
References	1  PubMed abstract 12098662
Domain Name	N/A
Hormone Name	Prolactin-releasing peptide PrRP20
Mature Hormone Sequence	RTPDINPAWYAGRGIRPVGRF
Position of mature hormone in Pre-Hormone protein	21 Residues from position (33-53)
Receptor	N/A
Gene ID	443466
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	10261
Swiss-prot Accession number	Q8MJ25 (Sequence in FASTA format)
Description	Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)](Fragment).
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2 are also secreted in selected neurons in the brain
Post translational modification	Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas (By similarity).
Function	Oxyntomodulin significantly reduces food intake
Protein Length	176 Amino acids
Molecular weight	20336
References	1   Limesand S.W., Hay W.W. Jr.; "Characterization of the endocrine pancreas in an ovine placentalinsufficiency IUGR fetus."; Submitted (JUL-2002) to the EMBL/GenBank/DDBJ databases.
Domain Name	Hormone_2
Hormone Name	Oxyntomodulin
Mature Hormone Sequence	HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
Position of mature hormone in Pre-Hormone protein	37 Residues from position (53-89)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 5

HMRbase accession number	10262
Swiss-prot Accession number	Q8MJ25 (Sequence in FASTA format)
Description	Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)](Fragment).
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2 are also secreted in selected neurons in the brain
Post translational modification	Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas (By similarity).
Function	Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia
Protein Length	176 Amino acids
Molecular weight	20336
References	1   Limesand S.W., Hay W.W. Jr.; "Characterization of the endocrine pancreas in an ovine placentalinsufficiency IUGR fetus."; Submitted (JUL-2002) to the EMBL/GenBank/DDBJ databases.
Domain Name	Hormone_2
Hormone Name	Glucagon
Mature Hormone Sequence	HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
Position of mature hormone in Pre-Hormone protein	29 Residues from position (53-81)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 6

HMRbase accession number	10263
Swiss-prot Accession number	Q8MJ25 (Sequence in FASTA format)
Description	Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)](Fragment).
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2 are also secreted in selected neurons in the brain
Post translational modification	Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas (By similarity).
Function	GLP-1 is a potent stimulator of glucose-dependent insulin release. Play important roles on gastric motility and the suppression of plasma glucagon levels. May be involved in the suppression of satiety and stimulation of glucose disposal in peripheral tissues, independent of the actions of insulin. Have growth-promoting activities on intestinal epithelium. May also regulate the hypothalamic pituitary axis (HPA) via effects on LH, TSH, CRH, oxytocin, and vasopressin
Protein Length	176 Amino acids
Molecular weight	20336
References	1   Limesand S.W., Hay W.W. Jr.; "Characterization of the endocrine pancreas in an ovine placentalinsufficiency IUGR fetus."; Submitted (JUL-2002) to the EMBL/GenBank/DDBJ databases.
Domain Name	Hormone_2
Hormone Name	Glucagon-like peptide 1
Mature Hormone Sequence	HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Position of mature hormone in Pre-Hormone protein	37 Residues from position (92-128)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 7

HMRbase accession number	10298
Swiss-prot Accession number	P07217 (Sequence in FASTA format)
Description	Somatoliberin (Growth hormone-releasing factor) (GRF) (Growth hormone-releasing hormone) (GHRH).
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone
Protein Length	44 Amino acids
Molecular weight	5123
References	1  PubMed abstract 6440561
Domain Name	Hormone_2
Hormone Name	Somatoliberin
Mature Hormone Sequence	YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL
Position of mature hormone in Pre-Hormone protein	44 Residues from position (1-44)
Receptor	Q8MHZ5   Detail in HMRbase    Q9BDI0    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 8

HMRbase accession number	10322
Swiss-prot Accession number	Q28588 (Sequence in FASTA format)
Description	Progonadoliberin-1 precursor (Progonadoliberin I) [Contains:Gonadoliberin-1 (Gonadoliberin I) (Luteinizing hormone-releasinghormone I) (LH-RH I) (Gonadotropin-releasing hormone I) (GnRH-I)(Luliberin I); GnRH-associated peptide 1 (GnRH-associated peptide I)](Fragment).
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the GnRH family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones
Protein Length	61 Amino acids
Molecular weight	6828
References	1   Rodriguez R.E., Wise M.E.; Submitted (OCT-1993) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 4550508
Domain Name	N/A
Hormone Name	Gonadoliberin-1
Mature Hormone Sequence	QHWSYGLRPG
Position of mature hormone in Pre-Hormone protein	10 Residues from position (1-10)
Receptor	P32237    Detail in HMRbase
Gene ID	N/A
PDB ID	1YY1
Drugpedia	wiki
Comments

Search Result - 9

HMRbase accession number	10596
Swiss-prot Accession number	P16038 (Sequence in FASTA format)
Description	Chorionic somatomammotropin hormone precursor (Placental lactogen)(PL).
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	236 Amino acids
Molecular weight	26695
References	1  PubMed abstract 2608069 2  PubMed abstract 8639711 3  PubMed abstract 10966654
Domain Name	Hormone_1
Hormone Name	Chorionic somatomammotropin hormone (Choriomammotropin) (Lactogen)
Mature Hormone Sequence	QAQHPPYCRNQPGKCQIPLQSLFDRATTVANYNSKLAGEMVNRFDEQYGQGINSESKVINCHTSSITTPNSKAEAINTEDKILFKLVISLLHSWDEPLHHAVTELANSKGTSPALLTKAQEIKEKAKVLVDGVEVIQKRIHPGEKNEPYPVWSEQSSLTSQDENVRRVAFYRLFHCLHRDSSKIYTYLRILKCRLTSCET
Position of mature hormone in Pre-Hormone protein	200 Residues from position (37-236)
Receptor	N/A
Gene ID	N/A
PDB ID	1F6F
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 10

HMRbase accession number	10693
Swiss-prot Accession number	P01301 (Sequence in FASTA format)
Description	Pancreatic prohormone precursor (Pancreatic polypeptide) (PP)[Contains: Pancreatic hormone; Pancreatic icosapeptide] (Fragment).
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the NPY family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions
Protein Length	59 Amino acids
Molecular weight	6698
References	1   Chance R.E., Moon N.E., Johnson M.G.; (In) Jaffe B.M., Behrman H.R. (eds.);Methods of hormone radioimmunoassay (2nd ed.), pp.657-672, AcademicPress, New York and London (1979). 2  PubMed abstract 6723953
Domain Name	Hormone_3
Hormone Name	Pancreatic hormone
Mature Hormone Sequence	ASLEPEYPGDNATPEQMAQYAAELRRYINMLTRPRY
Position of mature hormone in Pre-Hormone protein	36 Residues from position (1-36)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 11

HMRbase accession number	10694
Swiss-prot Accession number	P01301 (Sequence in FASTA format)
Description	Pancreatic prohormone precursor (Pancreatic polypeptide) (PP)[Contains: Pancreatic hormone; Pancreatic icosapeptide] (Fragment).
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the NPY family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	The physiological role for the icosapeptide has not yet been elucidated
Protein Length	59 Amino acids
Molecular weight	6698
References	1   Chance R.E., Moon N.E., Johnson M.G.; (In) Jaffe B.M., Behrman H.R. (eds.);Methods of hormone radioimmunoassay (2nd ed.), pp.657-672, AcademicPress, New York and London (1979). 2  PubMed abstract 6723953
Domain Name	Hormone_3
Hormone Name	Pancreatic icosapeptide
Mature Hormone Sequence	DKEGTLDFLECGSPHSAVPR
Position of mature hormone in Pre-Hormone protein	20 Residues from position (40-59)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 12

HMRbase accession number	10895
Swiss-prot Accession number	P01318 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	105 Amino acids
Molecular weight	11235
References	1  PubMed abstract 8011164 2  PubMed abstract 13249948 3  PubMed abstract 4626369
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FVNQHLCGSHLVEALYLVCGERGFFYTPKA
Position of mature hormone in Pre-Hormone protein	30 Residues from position (25-54)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 13

HMRbase accession number	10896
Swiss-prot Accession number	P01318 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	105 Amino acids
Molecular weight	11235
References	1  PubMed abstract 8011164 2  PubMed abstract 13249948 3  PubMed abstract 4626369
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCAGVCSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (85-105)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 14

HMRbase accession number	11036
Swiss-prot Accession number	P01261 (Sequence in FASTA format)
Description	Calcitonin precursor.
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the calcitonin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones
Protein Length	143 Amino acids
Molecular weight	15659
References	1  PubMed abstract 8482543 2   Sauer R., Niall H.D., Potts J.T. Jr.; "Accelerated procedures for automated peptide degradation."; Fed. Proc. 29:728-728(1970).
Domain Name	Calc_CGRP_IAPP
Hormone Name	Calcitonin
Mature Hormone Sequence	CSNLSTCVLSAYWKDLNNYHRYSGMGFGPETP
Position of mature hormone in Pre-Hormone protein	32 Residues from position (87-118)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 15

HMRbase accession number	11127
Swiss-prot Accession number	Q8MJ25 (Sequence in FASTA format)
Description	Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)](Fragment).
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2 are also secreted in selected neurons in the brain
Post translational modification	Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas (By similarity).
Function	Glicentin may modulate gastric acid secretion and gastro-pyloro-duodenal activity
Protein Length	176 Amino acids
Molecular weight	20336
References	1   Limesand S.W., Hay W.W. Jr.; "Characterization of the endocrine pancreas in an ovine placentalinsufficiency IUGR fetus."; Submitted (JUL-2002) to the EMBL/GenBank/DDBJ databases.
Domain Name	Hormone_2
Hormone Name	Glicentin
Mature Hormone Sequence	HSLQNTEEKSSSFPAPQTDPLGDPDQISEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
Position of mature hormone in Pre-Hormone protein	69 Residues from position (21-89)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 16

HMRbase accession number	11154
Swiss-prot Accession number	O02686 (Sequence in FASTA format)
Description	Gastrin precursor [Contains: Big gastrin (Gastrin 34) (G34); Gastrin].
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine
Protein Length	104 Amino acids
Molecular weight	11532
References	1  PubMed abstract 9522119 2  PubMed abstract 5665711
Domain Name	Gastrin
Hormone Name	Big gastrin
Mature Hormone Sequence	QLGLQDPPHMVADLSKKQGPWVEEEEAAYGWM
Position of mature hormone in Pre-Hormone protein	Residues from position 34
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 17

HMRbase accession number	11155
Swiss-prot Accession number	O02686 (Sequence in FASTA format)
Description	Gastrin precursor [Contains: Big gastrin (Gastrin 34) (G34); Gastrin].
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine
Protein Length	104 Amino acids
Molecular weight	11532
References	1  PubMed abstract 9522119 2  PubMed abstract 5665711
Domain Name	Gastrin
Hormone Name	Gastrin
Mature Hormone Sequence	QGPWVEEEEAAYGWMDF
Position of mature hormone in Pre-Hormone protein	17 Residues from position (76-92)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 18

HMRbase accession number	11159
Swiss-prot Accession number	P47851 (Sequence in FASTA format)
Description	Gastrin-releasing peptide precursor (GRP) [Contains: Neuromedin-C(GRP-10)].
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the bombesin/neuromedin-B/ranatensin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	GRP stimulates gastrin release as well as other gastrointestinal hormones. Operates as a negative feedback regulating fear and established a causal relationship between GRP-receptor gene expression, long-term potentiation, and amygdala-dependent memory for fear
Protein Length	134 Amino acids
Molecular weight	14855
References	1  PubMed abstract 7988429
Domain Name	Bombesin
Hormone Name	Gastrin-releasing peptide
Mature Hormone Sequence	APVTAGRAGALAKMYTRGNHWAVGHLM
Position of mature hormone in Pre-Hormone protein	27 Residues from position (24-50)
Receptor	N/A
Gene ID	443332
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 19

HMRbase accession number	11162
Swiss-prot Accession number	P31299 (Sequence in FASTA format)
Description	Secretin.
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates formation of NaHCO(3)-rich pancreatic juice and secretion of NaHCO(3)-rich bile and inhibits HCl production by the stomach
Protein Length	27 Amino acids
Molecular weight	3056
References	1  PubMed abstract 2034821
Domain Name	Hormone_2
Hormone Name	Secretin
Mature Hormone Sequence	HSDGTFTSELSRLRDSARLQRLLQGLV
Position of mature hormone in Pre-Hormone protein	27 Residues from position (1-27)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 20

HMRbase accession number	11236
Swiss-prot Accession number	O46688 (Sequence in FASTA format)
Description	Somatostatin precursor [Contains: Somatostatin-28; Somatostatin-14].
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatostatin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Somatostatin inhibits the release of somatotropin
Protein Length	116 Amino acids
Molecular weight	12689
References	1  PubMed abstract 9880082
Domain Name	Somatostatin
Hormone Name	Somatostatin-28
Mature Hormone Sequence	SANSNPAMAPRERKAGCKNFFWKTFTSC
Position of mature hormone in Pre-Hormone protein	28 Residues from position (89-116)
Receptor	Q8MI04    Detail in HMRbase
Gene ID	443006
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 21

HMRbase accession number	11241
Swiss-prot Accession number	P01142 (Sequence in FASTA format)
Description	Corticoliberin precursor (Corticotropin-releasing factor) (CRF)(Corticotropin-releasing hormone) (Endorpholiberin).
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	This hormone from hypothalamus regulates the release of corticotropin from pituitary gland
Protein Length	190 Amino acids
Molecular weight	20672
References	1  PubMed abstract 6600512 2  PubMed abstract 3265687 3  PubMed abstract 6273874 4  PubMed abstract 6267699 5  PubMed abstract 2647152
Domain Name	CRF
Hormone Name	Corticoliberin
Mature Hormone Sequence	SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA
Position of mature hormone in Pre-Hormone protein	41 Residues from position (148-188)
Receptor	O62772    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 22

HMRbase accession number	11266
Swiss-prot Accession number	P01191 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin] (Fragment).
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes
Protein Length	212 Amino acids
Molecular weight	23464
References	1  PubMed abstract 8384993 2   Leonis J., Li C.H., Chung D.; "Corticotropins (ACTH). XV. The action of chymotrypsin on alpha-corticotropin."; J. Am. Chem. Soc. 81:419-423(1959). 3  PubMed abstract 4344689 4  PubMed abstract 4370084 5  PubMed abstract 13929167 6  PubMed abstract 4162144 7  PubMed abstract 4675453 8  PubMed abstract 4270658 9  PubMed abstract 843377 10  PubMed abstract 8384993 11   Leonis J., Li C.H., Chung D.; "Corticotropins (ACTH). XV. The action of chymotrypsin on alpha-corticotropin."; J. Am. Chem. Soc. 81:419-423(1959). 12  PubMed abstract 4344689 13  PubMed abstract 4370084 14  PubMed abstract 13929167 15  PubMed abstract 4162144 16  PubMed abstract 4675453 17  PubMed abstract 4270658 18  PubMed abstract 843377
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Melanotropin gamma (Gamma-MSH)
Mature Hormone Sequence	YVMGHFRWDRF
Position of mature hormone in Pre-Hormone protein	11 Residues from position (26-36)
Receptor	Q9TU77   Detail in HMRbase    O19037    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 23

HMRbase accession number	11267
Swiss-prot Accession number	P01191 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin] (Fragment).
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	ACTH stimulates the adrenal glands to release cortisol
Protein Length	212 Amino acids
Molecular weight	23464
References	1  PubMed abstract 8384993 2   Leonis J., Li C.H., Chung D.; "Corticotropins (ACTH). XV. The action of chymotrypsin on alpha-corticotropin."; J. Am. Chem. Soc. 81:419-423(1959). 3  PubMed abstract 4344689 4  PubMed abstract 4370084 5  PubMed abstract 13929167 6  PubMed abstract 4162144 7  PubMed abstract 4675453 8  PubMed abstract 4270658 9  PubMed abstract 843377 10  PubMed abstract 8384993 11   Leonis J., Li C.H., Chung D.; "Corticotropins (ACTH). XV. The action of chymotrypsin on alpha-corticotropin."; J. Am. Chem. Soc. 81:419-423(1959). 12  PubMed abstract 4344689 13  PubMed abstract 4370084 14  PubMed abstract 13929167 15  PubMed abstract 4162144 16  PubMed abstract 4675453 17  PubMed abstract 4270658 18  PubMed abstract 843377
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Corticotropin
Mature Hormone Sequence	SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAQAFPLEF
Position of mature hormone in Pre-Hormone protein	39 Residues from position (81-119)
Receptor	Q9TU77   Detail in HMRbase    O19037    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 24

HMRbase accession number	11268
Swiss-prot Accession number	P01191 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin] (Fragment).
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes
Protein Length	212 Amino acids
Molecular weight	23464
References	1  PubMed abstract 8384993 2   Leonis J., Li C.H., Chung D.; "Corticotropins (ACTH). XV. The action of chymotrypsin on alpha-corticotropin."; J. Am. Chem. Soc. 81:419-423(1959). 3  PubMed abstract 4344689 4  PubMed abstract 4370084 5  PubMed abstract 13929167 6  PubMed abstract 4162144 7  PubMed abstract 4675453 8  PubMed abstract 4270658 9  PubMed abstract 843377 10  PubMed abstract 8384993 11   Leonis J., Li C.H., Chung D.; "Corticotropins (ACTH). XV. The action of chymotrypsin on alpha-corticotropin."; J. Am. Chem. Soc. 81:419-423(1959). 12  PubMed abstract 4344689 13  PubMed abstract 4370084 14  PubMed abstract 13929167 15  PubMed abstract 4162144 16  PubMed abstract 4675453 17  PubMed abstract 4270658 18  PubMed abstract 843377
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Melanotropin alpha (Alpha-MSH)
Mature Hormone Sequence	SYSMEHFRWGKPV
Position of mature hormone in Pre-Hormone protein	13 Residues from position (81-93)
Receptor	Q9TU77   Detail in HMRbase    O19037    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 25

HMRbase accession number	11269
Swiss-prot Accession number	P01191 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin] (Fragment).
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Stimulates melanocytes to produce melanin. It performs lipid-mobilizing functions such as lipolysis and steroidogenesis.
Protein Length	212 Amino acids
Molecular weight	23464
References	1  PubMed abstract 8384993 2   Leonis J., Li C.H., Chung D.; "Corticotropins (ACTH). XV. The action of chymotrypsin on alpha-corticotropin."; J. Am. Chem. Soc. 81:419-423(1959). 3  PubMed abstract 4344689 4  PubMed abstract 4370084 5  PubMed abstract 13929167 6  PubMed abstract 4162144 7  PubMed abstract 4675453 8  PubMed abstract 4270658 9  PubMed abstract 843377 10  PubMed abstract 8384993 11   Leonis J., Li C.H., Chung D.; "Corticotropins (ACTH). XV. The action of chymotrypsin on alpha-corticotropin."; J. Am. Chem. Soc. 81:419-423(1959). 12  PubMed abstract 4344689 13  PubMed abstract 4370084 14  PubMed abstract 13929167 15  PubMed abstract 4162144 16  PubMed abstract 4675453 17  PubMed abstract 4270658 18  PubMed abstract 843377
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Lipotropin beta (Beta-LPH)
Mature Hormone Sequence	ELTGERLEQARGPEAQAESAAARAELEYGLVAEAEAAEKKDSGPYKMEHFRWGSPPKDKRYGGFMTSEKSQTPLVTLFKNAIIKNAHKK
Position of mature hormone in Pre-Hormone protein	91 Residues from position (122-212)
Receptor	Q9TU77   Detail in HMRbase    O19037    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 26

HMRbase accession number	11270
Swiss-prot Accession number	P01191 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin] (Fragment).
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Stimulates melanocytes to produce melanin. It performs lipid-mobilizing functions such as lipolysis and steroidogenesis.
Protein Length	212 Amino acids
Molecular weight	23464
References	1  PubMed abstract 8384993 2   Leonis J., Li C.H., Chung D.; "Corticotropins (ACTH). XV. The action of chymotrypsin on alpha-corticotropin."; J. Am. Chem. Soc. 81:419-423(1959). 3  PubMed abstract 4344689 4  PubMed abstract 4370084 5  PubMed abstract 13929167 6  PubMed abstract 4162144 7  PubMed abstract 4675453 8  PubMed abstract 4270658 9  PubMed abstract 843377 10  PubMed abstract 8384993 11   Leonis J., Li C.H., Chung D.; "Corticotropins (ACTH). XV. The action of chymotrypsin on alpha-corticotropin."; J. Am. Chem. Soc. 81:419-423(1959). 12  PubMed abstract 4344689 13  PubMed abstract 4370084 14  PubMed abstract 13929167 15  PubMed abstract 4162144 16  PubMed abstract 4675453 17  PubMed abstract 4270658 18  PubMed abstract 843377
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Lipotropin gamma (Gamma-LPH)
Mature Hormone Sequence	ELTGERLEQARGPEAQAESAAARAELEYGLVAEAEAAEKKDSGPYKMEHFRWGSPPKD
Position of mature hormone in Pre-Hormone protein	58 Residues from position (122-179)
Receptor	Q9TU77   Detail in HMRbase    O19037    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 27

HMRbase accession number	11271
Swiss-prot Accession number	P01191 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin] (Fragment).
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes
Protein Length	212 Amino acids
Molecular weight	23464
References	1  PubMed abstract 8384993 2   Leonis J., Li C.H., Chung D.; "Corticotropins (ACTH). XV. The action of chymotrypsin on alpha-corticotropin."; J. Am. Chem. Soc. 81:419-423(1959). 3  PubMed abstract 4344689 4  PubMed abstract 4370084 5  PubMed abstract 13929167 6  PubMed abstract 4162144 7  PubMed abstract 4675453 8  PubMed abstract 4270658 9  PubMed abstract 843377 10  PubMed abstract 8384993 11   Leonis J., Li C.H., Chung D.; "Corticotropins (ACTH). XV. The action of chymotrypsin on alpha-corticotropin."; J. Am. Chem. Soc. 81:419-423(1959). 12  PubMed abstract 4344689 13  PubMed abstract 4370084 14  PubMed abstract 13929167 15  PubMed abstract 4162144 16  PubMed abstract 4675453 17  PubMed abstract 4270658 18  PubMed abstract 843377
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Melanotropin beta (Beta-MSH)
Mature Hormone Sequence	DSGPYKMEHFRWGSPPKD
Position of mature hormone in Pre-Hormone protein	18 Residues from position (162-179)
Receptor	Q9TU77   Detail in HMRbase    O19037    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 28

HMRbase accession number	11272
Swiss-prot Accession number	P01191 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin] (Fragment).
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Beta-endorphin is an endogenous opiate
Protein Length	212 Amino acids
Molecular weight	23464
References	1  PubMed abstract 8384993 2   Leonis J., Li C.H., Chung D.; "Corticotropins (ACTH). XV. The action of chymotrypsin on alpha-corticotropin."; J. Am. Chem. Soc. 81:419-423(1959). 3  PubMed abstract 4344689 4  PubMed abstract 4370084 5  PubMed abstract 13929167 6  PubMed abstract 4162144 7  PubMed abstract 4675453 8  PubMed abstract 4270658 9  PubMed abstract 843377 10  PubMed abstract 8384993 11   Leonis J., Li C.H., Chung D.; "Corticotropins (ACTH). XV. The action of chymotrypsin on alpha-corticotropin."; J. Am. Chem. Soc. 81:419-423(1959). 12  PubMed abstract 4344689 13  PubMed abstract 4370084 14  PubMed abstract 13929167 15  PubMed abstract 4162144 16  PubMed abstract 4675453 17  PubMed abstract 4270658 18  PubMed abstract 843377
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Beta-endorphin
Mature Hormone Sequence	YGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ
Position of mature hormone in Pre-Hormone protein	31 Residues from position (182-212)
Receptor	Q9TU77   Detail in HMRbase    O19037    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 29

HMRbase accession number	11273
Swiss-prot Accession number	P01191 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin] (Fragment).
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Met-enkephalin is an endogenous opiate
Protein Length	212 Amino acids
Molecular weight	23464
References	1  PubMed abstract 8384993 2   Leonis J., Li C.H., Chung D.; "Corticotropins (ACTH). XV. The action of chymotrypsin on alpha-corticotropin."; J. Am. Chem. Soc. 81:419-423(1959). 3  PubMed abstract 4344689 4  PubMed abstract 4370084 5  PubMed abstract 13929167 6  PubMed abstract 4162144 7  PubMed abstract 4675453 8  PubMed abstract 4270658 9  PubMed abstract 843377 10  PubMed abstract 8384993 11   Leonis J., Li C.H., Chung D.; "Corticotropins (ACTH). XV. The action of chymotrypsin on alpha-corticotropin."; J. Am. Chem. Soc. 81:419-423(1959). 12  PubMed abstract 4344689 13  PubMed abstract 4370084 14  PubMed abstract 13929167 15  PubMed abstract 4162144 16  PubMed abstract 4675453 17  PubMed abstract 4270658 18  PubMed abstract 843377
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Met-enkephalin
Mature Hormone Sequence	YGGFM
Position of mature hormone in Pre-Hormone protein	5 Residues from position (182-186)
Receptor	Q9TU77   Detail in HMRbase    O19037    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 30

HMRbase accession number	11302
Swiss-prot Accession number	P01218 (Sequence in FASTA format)
Description	Glycoprotein hormones alpha chain precursor (Anterior pituitaryglycoprotein hormones common subunit alpha) (Follitropin alpha chain)(Follicle-stimulating hormone alpha chain) (FSH-alpha) (Lutropin alphachain) (LH alpha 3) (Luteinizing hormone alpha chain) (LSH-alpha)(Thyrotropin alpha chain) (Thyroid-stimulating hormone alpha chain)(TSH-alpha) [Contains: LH alpha 1-1; LH alpha 1-2; LH alpha 1-3].
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit alpha family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	120 Amino acids
Molecular weight	13588
References	1  PubMed abstract 2481272 2  PubMed abstract 5064343 3  PubMed abstract 4676903 4  PubMed abstract 6798968 5  PubMed abstract 2456202 6   Chung D., Sairam M.R., Li C.H.; "The primary structure of ovine interstitial cell-stimulating hormone.III. Disulfide bridges of the alpha-subunit."; Arch. Biochem. Biophys. 159:678-682(1973). 7  PubMed abstract 2209620 8  PubMed abstract 2481272 9  PubMed abstract 5064343 10  PubMed abstract 4676903 11  PubMed abstract 6798968 12  PubMed abstract 2456202 13   Chung D., Sairam M.R., Li C.H.; "The primary structure of ovine interstitial cell-stimulating hormone.III. Disulfide bridges of the alpha-subunit."; Arch. Biochem. Biophys. 159:678-682(1973). 14  PubMed abstract 2209620
Domain Name	Hormone_6
Hormone Name	Glycoprotein hormones alpha chain
Mature Hormone Sequence	FPDGEFTMQGCPECKLKENKYFSKPDAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNVRVENHTECHCSTCYYHKS
Position of mature hormone in Pre-Hormone protein	96 Residues from position (25-120)
Receptor	P35379   Detail in HMRbase    Q28585   Detail in HMRbase    P56495    Detail in HMRbase
Gene ID	443538
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 31

HMRbase accession number	11309
Swiss-prot Accession number	P01227 (Sequence in FASTA format)
Description	Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	129 Amino acids
Molecular weight	14669
References	1  PubMed abstract 2505233 2  PubMed abstract 1930694 3  PubMed abstract 6798969 4  PubMed abstract 2505233 5  PubMed abstract 1930694 6  PubMed abstract 6798969
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	SCELTNITITVEKEECSFCISINTTWCAGYCYTRDLVYKDPARPNIQKACTFKELVYETVKVPGCAHHADSLYTYPVATECHCGKCDRDSTDCTVRGLGPSYCSFSDIRE
Position of mature hormone in Pre-Hormone protein	110 Residues from position (20-129)
Receptor	P35379    Detail in HMRbase
Gene ID	443387
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 32

HMRbase accession number	11312
Swiss-prot Accession number	P01231 (Sequence in FASTA format)
Description	Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain) (Interstitial cell-stimulating hormone) [Contains: LH beta-1; LH beta-2; LH beta-3].
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids. The LH alpha 3/LH beta 3 heterodimer was shown to have potent renotropic and weak gonadotropic activity
Protein Length	141 Amino acids
Molecular weight	15184
References	1  PubMed abstract 8349025 2  PubMed abstract 2336396 3  PubMed abstract 4556309 4  PubMed abstract 4575435 5  PubMed abstract 2456202 6  PubMed abstract 1201911 7  PubMed abstract 2209620
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	SRGPLRPLCQPINATLAAEKEACPVCITFTTSICAGYCLSMKRVLPVILPPMPQRVCTYHELRFASVRLPGCPPGVDPMVSFPVALSCHCGPCRLSSTDCGGPRTQPLACDHPPLPDILFL
Position of mature hormone in Pre-Hormone protein	121 Residues from position (21-141)
Receptor	Q28585    Detail in HMRbase
Gene ID	443395
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 33

HMRbase accession number	11318
Swiss-prot Accession number	P01240 (Sequence in FASTA format)
Description	Prolactin precursor (PRL).
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Prolactin acts primarily on the mammary gland by promoting lactation, mammogenesis, mitogenesis and osmoregulation
Protein Length	229 Amino acids
Molecular weight	25778
References	1  PubMed abstract 2911473 2  PubMed abstract 2666265 3  PubMed abstract 7969789 4  PubMed abstract 5497153 5  PubMed abstract 1270193
Domain Name	Hormone_1
Hormone Name	Prolactin
Mature Hormone Sequence	TPVCPNGPGNCQVSLRDLFDRAVMVSHYIHNLSSEMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHLVTEVRGMKGVPDAILSRAIEIEEENKRLLEGMEMIFGQVIPGAKETEPYPVWSGLPSLQTKDEDARHSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC
Position of mature hormone in Pre-Hormone protein	199 Residues from position (31-229)
Receptor	O46561    Detail in HMRbase
Gene ID	443317
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 34

HMRbase accession number	11406
Swiss-prot Accession number	P13389 (Sequence in FASTA format)
Description	Oxytocin-neurophysin 1 precursor (OT-NPI) [Contains: Oxytocin(Ocytocin); Neurophysin 1].
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the vasopressin/oxytocin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland
Protein Length	125 Amino acids
Molecular weight	12635
References	1  PubMed abstract 2798140 2  PubMed abstract 2095591 3   Acher R., Chauvet J., Lenci M.T.; "Purification and structure of sheep oxytocin and vasopressin."; C. R. Acad. Sci., D, Sci. Nat. 248:1435-1438(1959).
Domain Name	Hormone_5
Hormone Name	Oxytocin
Mature Hormone Sequence	CYIQNCPLG
Position of mature hormone in Pre-Hormone protein	9 Residues from position (20-28)
Receptor	Q28756    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 35

HMRbase accession number	11407
Swiss-prot Accession number	P13389 (Sequence in FASTA format)
Description	Oxytocin-neurophysin 1 precursor (OT-NPI) [Contains: Oxytocin(Ocytocin); Neurophysin 1].
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the vasopressin/oxytocin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Neurophysin 1 specifically binds oxytocin
Protein Length	125 Amino acids
Molecular weight	12635
References	1  PubMed abstract 2798140 2  PubMed abstract 2095591 3   Acher R., Chauvet J., Lenci M.T.; "Purification and structure of sheep oxytocin and vasopressin."; C. R. Acad. Sci., D, Sci. Nat. 248:1435-1438(1959).
Domain Name	Hormone_5
Hormone Name	Neurophysin 1
Mature Hormone Sequence	AVLDLDVRTCLPCGPGGKGRCFGPSICCGDELGCFVGTAEALRCREENYLPSPCQSGQKPCGSGGRCAAAGICCSPDGCHADPACDPEAAFSQH
Position of mature hormone in Pre-Hormone protein	94 Residues from position (32-125)
Receptor	Q28756    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 36

HMRbase accession number	11492
Swiss-prot Accession number	P62969 (Sequence in FASTA format)
Description	Thyroliberin (Thyrotropin-releasing hormone) (TRH) (Thyrotropin-releasing factor) (TRF) (TSH-releasing factor) (Protirelin).
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the TRH family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Functions as a regulator of the biosynthesis of TSH in the anterior pituitary gland and as a neurotransmitter/ neuromodulator in the central and peripheral nervous systems
Protein Length	3 Amino acids
Molecular weight	380
References	1   Desiderio D.M. Jr., Burgus R., Dunn T.F., Vale W., Guillemin R.,Ward D.N.; "The elucidation of the primary structure of the hypothalamic thyroidstimulating hormone releasing factor of ovine origin by means of massspectrometry."; Org. Mass Spectrom. 5:221-228(1971). 2  PubMed abstract 4985794
Domain Name	N/A
Hormone Name	Thyroliberin
Mature Hormone Sequence	QHP
Position of mature hormone in Pre-Hormone protein	3 Residues from position (1-3)
Receptor	Q28596    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 37

HMRbase accession number	11494
Swiss-prot Accession number	P67930 (Sequence in FASTA format)
Description	Somatotropin precursor (Growth hormone).
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues
Protein Length	217 Amino acids
Molecular weight	24631
References	1  PubMed abstract 3453044 2  PubMed abstract 3174441 3  PubMed abstract 2660907 4  PubMed abstract 1459643 5  PubMed abstract 9321473 6  PubMed abstract 4736985 7  PubMed abstract 5062423
Domain Name	Hormone_1
Hormone Name	Somatotropin
Mature Hormone Sequence	FPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGILALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMKCRRFGEASCAF
Position of mature hormone in Pre-Hormone protein	190 Residues from position (28-217)
Receptor	Q28575    Detail in HMRbase
Gene ID	443329
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 38

HMRbase accession number	11540
Swiss-prot Accession number	Q28603 (Sequence in FASTA format)
Description	Leptin;Alternative Name: Obesity factor
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	Secreted (Probable)
Developmental Stage	N/A
Similarity	Belongs to the leptin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass.
Protein Length	146 Amino acids
Molecular weight	16054
References	1  PubMed abstract 9347250
Domain Name	Leptin
Hormone Name	Leptin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	Q863E2   Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 39

HMRbase accession number	11580
Swiss-prot Accession number	P52115 (Sequence in FASTA format)
Description	Renin; EC=3.4.23.15;Alternative Name: Angiotensinogenase;Precursor
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	Secreted (By similarity). Membrane (By similarity). Note=Associated to membranes via binding to ATP6AP2 (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the peptidase A1 family.
Tissue Specificity	Kidney
Post translational modification	N/A
Function	Renin is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney.
Protein Length	400 Amino acids
Molecular weight	44016
References	1  PubMed abstract 1543532
Domain Name	A1_Propeptide  Asp
Hormone Name	Renin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	N/A
Gene ID	443310
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated